Tissue Repair Research

LL-37

Human cathelicidin

Also known as Cathelicidin LL-37, hCAP18 (134–170), CAP-18.

The 37-residue active fragment of human cathelicidin (hCAP18), an antimicrobial and immunomodulatory peptide used in innate-immunity and wound-model research.

Current lot: SN-LL3-2606
Purity: 98.96% by HPLC
Tested: Jun 12, 2026
Stocked in: United States, Canada

Synamino Sciences research vial with a silver cap on a slate-blue background

Ships from

Vial size

$42.00

USD · 5 mg · In stock

Qty

Order by 2:00 PM PT for same-day dispatch from Reno, Nevada. 1–3 business days by USPS Priority and UPS. Free shipping over $150.00.

For laboratory research use only. Not for human or veterinary use.

About the compound

LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans. It is studied for membrane interactions with bacteria, chemotaxis of immune cells and keratinocyte behaviour in wound models.

Supplied as a lyophilized powder; the peptide is amphipathic and should be handled according to your laboratory's protocol for cationic peptides.

Studied inInnate immunity · Antimicrobial peptides · Keratinocyte migration

Certificate of analysis

The certificate for the lot currently shipping. Every vial in that lot carries the same lot number on its label.

Certificate of analysis

LL-37 · 5 mg

Lot SN-LL3-2606 · tested Jun 12, 2026

98.96%

Purity by HPLC

Labeled: 5 mg
Measured: 5.1 mg
Panel: 6 passed · 2 reported
Laboratory: Independent ISO/IEC 17025 accredited laboratory

Assay	Method	Result	Outcome
Appearance	Visual	White lyophilized powder	Pass
Purity	HPLC · spec ≥ 98%	98.96%	Pass
Net peptide content	HPLC	5.1 mg	Reported
Identity	LC-MS	Confirmed	Pass
Heavy metals	ICP-MS	Not detected	Pass
Sterility	USP <71>	No growth	Pass
Endotoxin	LAL · USP <85>	< 0.05 EU/mL	Reported
Residual solvents	GC-HS	Within limits	Pass

Specification and storage

CAS number: 154947-66-7
Molecular formula: C205H340N60O53
Molecular weight: 4493.3 g/mol
Residues: 37
Sequence: [LL-37, 37 aa]
Reference record: PubChem entry

Storage

Sealed lyophilized vials are stable at room temperature for short periods; store at 2–8 °C for routine use.
For long-term storage keep sealed vials at −20 °C, protected from light and moisture.
Reconstituted solutions should be refrigerated at 2–8 °C and used within the period defined by your laboratory's protocol.

Literature

Peer-reviewed publications on this compound. Provided for reference; they are not claims about this product.

01
Proceedings of the National Academy of Sciences · 1995
FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis
Agerberth B, Gunne H, Odeberg J, et al.
02
Blood · 2001
Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3
Sørensen OE, Follin P, Johnsen AH, et al.
03
Biochimica et Biophysica Acta · 2006
LL-37, the only human member of the cathelicidin family of antimicrobial peptides
Dürr UH, Sudheendra US, Ramamoorthy A

Studied alongside

KPV
α-MSH tripeptide
from $38.00
Thymosin Alpha-1
Immune-signalling peptide
from $44.00
BPC-157
Pentadecapeptide
from $32.00

Research notice

LL-37 is supplied for in vitro laboratory research and analytical use by qualified professionals. It is not a medicine, supplement or cosmetic, has not been evaluated by any regulator, and is not for human or veterinary use. Published findings cited on this page are provided for reference and are not claims about this product.